Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [186838] (2 PDB entries) |
Domain d1wx0e_: 1wx0 E: [121386] Other proteins in same PDB: d1wx0a1 automated match to d1vpxa_ |
PDB Entry: 1wx0 (more details), 2.27 Å
SCOPe Domain Sequences for d1wx0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wx0e_ c.1.10.0 (E:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv teaallgadiatmphavfkqllkhpltdigl
Timeline for d1wx0e_: