| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [186838] (2 PDB entries) |
| Domain d1wx0b_: 1wx0 B: [121383] Other proteins in same PDB: d1wx0a1 automated match to d1vpxa_ |
PDB Entry: 1wx0 (more details), 2.27 Å
SCOPe Domain Sequences for d1wx0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wx0b_ c.1.10.0 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
teaallgadiatmphavfkqllkhpltdigl
Timeline for d1wx0b_: