Lineage for d1wx0a1 (1wx0 A:1-211)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834467Protein Decameric fructose-6-phosphate aldolase/transaldolase [75085] (3 species)
    forms helix-swapped pentamers
  7. 2834500Species Thermus thermophilus [TaxId:274] [141836] (1 PDB entry)
    Uniprot Q5SJE8 1-211
    clear orthologue of the E.coli protein; annotated as transaldolase in UniProt
  8. 2834501Domain d1wx0a1: 1wx0 A:1-211 [121382]
    Other proteins in same PDB: d1wx0b_, d1wx0c_, d1wx0d_, d1wx0e_, d1wx0f_, d1wx0g_, d1wx0h_, d1wx0i_, d1wx0j_

Details for d1wx0a1

PDB Entry: 1wx0 (more details), 2.27 Å

PDB Description: Crystal structure of transaldolase from Thermus thermophilus HB8
PDB Compounds: (A:) Transaldolase

SCOPe Domain Sequences for d1wx0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wx0a1 c.1.10.1 (A:1-211) Decameric fructose-6-phosphate aldolase/transaldolase {Thermus thermophilus [TaxId: 274]}
melyldtasleeireiaawgvlsgvttnptlvakafaakgealteeafaahlraicetvg
gpvsaevtaleaeamvaegrrlaaihpnivvklptteeglkackrlsaegikvnmtlifs
anqallaaragasyvspflgrvddiswdggellreivemiqvqdlpvkviaasirhprhv
teaallgadiatmphavfkqllkhpltdigl

SCOPe Domain Coordinates for d1wx0a1:

Click to download the PDB-style file with coordinates for d1wx0a1.
(The format of our PDB-style files is described here.)

Timeline for d1wx0a1: