SCOPe 2.05: Domain d1wwza1: 1wwz A:1-157

Lineage for d1wwza1 (1wwz A:1-157)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PH1933 [143648] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143649] (1 PDB entry)
   Uniprot O59596 1-157

8. Domain d1wwza1: 1wwz A:1-157 [121380]
   complexed with aco

Details for d1wwza1

PDB Entry: 1wwz, 1.75 Å

PDB Description: Crystal structure of PH1933 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PH1933

SCOPe Domain Sequences for d1wwza1:

Sequence; same for both SEQRES and ATOM records:

>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]}
mdeikieklkkldkkalnelidvymsgyegleeyggegrdyarnyikwcwkkasdgffva
kvgdkivgfivcdkdwfskyegrivgaihefvvdkkfqgkgigrkllitcldflgkyndt
ielwvgeknygamnlyekfgfkkvgksgiwvrmikrq

Timeline for d1wwza1:

• d1wwza1 first appeared in SCOP 1.73
  
• d1wwza1 appears in SCOPe 2.04
  
• d1wwza1 appears in SCOPe 2.06
  
• d1wwza1 appears in the current release, SCOPe 2.08