Lineage for d1wwxa1 (1wwx A:8-101)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983123Family a.4.5.21: ets domain [46859] (9 proteins)
  6. 1983124Protein E74-like factor 5 ese-2b [140269] (1 species)
  7. 1983125Species Human (Homo sapiens) [TaxId:9606] [140270] (1 PDB entry)
    Uniprot Q9UKW6 173-265
  8. 1983126Domain d1wwxa1: 1wwx A:8-101 [121379]
    Other proteins in same PDB: d1wwxa2, d1wwxa3

Details for d1wwxa1

PDB Entry: 1wwx (more details)

PDB Description: solution structure of the ets-domain of the ets domain transcription factor
PDB Compounds: (A:) E74-like factor 5 ESE-2b

SCOPe Domain Sequences for d1wwxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]}
sshlwefvrdlllspeencgilewedreqgifrvvksealakmwgqrkkndrmtyeklsr
alryyyktgilervdrrlvykfgknahgwqedkl

SCOPe Domain Coordinates for d1wwxa1:

Click to download the PDB-style file with coordinates for d1wwxa1.
(The format of our PDB-style files is described here.)

Timeline for d1wwxa1: