Lineage for d1wwva1 (1wwv A:8-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715487Protein Connector enhancer of kinase suppressor of Ras 1, CNK1 [140618] (1 species)
  7. 2715488Species Human (Homo sapiens) [TaxId:9606] [140619] (1 PDB entry)
    Uniprot Q969H4 1-78
  8. 2715489Domain d1wwva1: 1wwv A:8-85 [121378]
    Other proteins in same PDB: d1wwva2, d1wwva3

Details for d1wwva1

PDB Entry: 1wwv (more details)

PDB Description: solution structure of the sam domain of human connector enhancer of ksr-like protein cnk1
PDB Compounds: (A:) Connector enhancer of kinase suppressor of ras 1

SCOPe Domain Sequences for d1wwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]}
mepvetwtpgkvatwlrglddslqdypfedwqlpgknllqlcpqslealavrslghqeli
lggveqlqalssrlqten

SCOPe Domain Coordinates for d1wwva1:

Click to download the PDB-style file with coordinates for d1wwva1.
(The format of our PDB-style files is described here.)

Timeline for d1wwva1: