Class a: All alpha proteins [46456] (290 folds) |
Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein Connector enhancer of kinase suppressor of Ras 1, CNK1 [140618] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140619] (1 PDB entry) Uniprot Q969H4 1-78 |
Domain d1wwva1: 1wwv A:8-85 [121378] Other proteins in same PDB: d1wwva2, d1wwva3 |
PDB Entry: 1wwv (more details)
SCOPe Domain Sequences for d1wwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwva1 a.60.1.2 (A:8-85) Connector enhancer of kinase suppressor of Ras 1, CNK1 {Human (Homo sapiens) [TaxId: 9606]} mepvetwtpgkvatwlrglddslqdypfedwqlpgknllqlcpqslealavrslghqeli lggveqlqalssrlqten
Timeline for d1wwva1: