![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.4: Bacterial histone-fold protein [101318] (3 proteins) duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer automatically mapped to Pfam PF09123 |
![]() | Protein automated matches [190817] (1 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [188097] (1 PDB entry) |
![]() | Domain d1wwsc_: 1wws C: [121372] automated match to d1wwia1 complexed with ca |
PDB Entry: 1wws (more details), 1.9 Å
SCOPe Domain Sequences for d1wwsc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwsc_ a.22.1.4 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar vlkeldpalknpqtehheraervfnlll
Timeline for d1wwsc_: