Lineage for d1wwsb_ (1wws B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311419Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2311420Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2312571Family a.22.1.4: Bacterial histone-fold protein [101318] (3 proteins)
    duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer
    automatically mapped to Pfam PF09123
  6. 2312578Protein automated matches [190817] (1 species)
    not a true protein
  7. 2312579Species Thermus thermophilus HB8 [TaxId:300852] [188097] (1 PDB entry)
  8. 2312581Domain d1wwsb_: 1wws B: [121371]
    automated match to d1wwia1
    complexed with ca

Details for d1wwsb_

PDB Entry: 1wws (more details), 1.9 Å

PDB Description: Crystal structure of ttk003001566 from Thermus Thermophilus HB8
PDB Compounds: (B:) hypothetical protein TTHA1479

SCOPe Domain Sequences for d1wwsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwsb_ a.22.1.4 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
vlkeldpalknpqtehheraervfnlll

SCOPe Domain Coordinates for d1wwsb_:

Click to download the PDB-style file with coordinates for d1wwsb_.
(The format of our PDB-style files is described here.)

Timeline for d1wwsb_: