Lineage for d1wwsb1 (1wws B:1-148)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637441Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 637442Superfamily a.22.1: Histone-fold [47113] (4 families) (S)
  5. 637795Family a.22.1.4: Bacterial histone-fold protein [101318] (2 proteins)
    duplication: two repeats of histone fold are arranged as subunits in the archael histone dimer; new structure from Thermus thermophilus (1wws) comprised of dimers similar the to the H3-H4 tetramer
  6. 637799Protein Hypothetical protein TTHA1479 [140402] (1 species)
  7. 637800Species Thermus thermophilus [TaxId:274] [140403] (2 PDB entries)
  8. 637803Domain d1wwsb1: 1wws B:1-148 [121371]
    automatically matched to 1WWI A:1-148
    complexed with ca

Details for d1wwsb1

PDB Entry: 1wws (more details), 1.9 Å

PDB Description: Crystal structure of ttk003001566 from Thermus Thermophilus HB8
PDB Compounds: (B:) hypothetical protein TTHA1479

SCOP Domain Sequences for d1wwsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwsb1 a.22.1.4 (B:1-148) Hypothetical protein TTHA1479 {Thermus thermophilus [TaxId: 274]}
mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
vlkeldpalknpqtehheraervfnlll

SCOP Domain Coordinates for d1wwsb1:

Click to download the PDB-style file with coordinates for d1wwsb1.
(The format of our PDB-style files is described here.)

Timeline for d1wwsb1: