SCOPe 2.06: Domain d1wwrc2: 1wwr C:1-151

Lineage for d1wwrc2 (1wwr C:1-151)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
   strand 5 is parallel to strand 4

6. Protein tRNA adenosine deaminase TadA [142840] (3 species)

7. Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry)
   Uniprot O67050 1-151

8. Domain d1wwrc2: 1wwr C:1-151 [121368]
   Other proteins in same PDB: d1wwra2, d1wwrb3, d1wwrc3
   automated match to d1wwra1
   complexed with zn

Details for d1wwrc2

PDB Entry: 1wwr, 1.8 Å

PDB Description: Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus

PDB Compounds: (C:) tRNA adenosine deaminase TadA

SCOPe Domain Sequences for d1wwrc2:

Sequence; same for both SEQRES and ATOM records:

>d1wwrc2 c.97.1.2 (C:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]}
mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike
acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept
lnhrvkweyypleeasellseffkklrnnii

Timeline for d1wwrc2:

• d1wwrc2 first appeared in SCOP 1.73, called d1wwrc1
  
• d1wwrc2 was called d1wwrc_ in SCOPe 2.05
  
• d1wwrc2 appears in SCOPe 2.07
  
• d1wwrc2 appears in the current release, SCOPe 2.08