Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) contains extra C-terminal strand 5, order 21345 |
Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins) strand 5 is parallel to strand 4 |
Protein tRNA adenosine deaminase TadA [142840] (3 species) |
Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry) |
Domain d1wwrc1: 1wwr C:1-151 [121368] automatically matched to 1WWR A:1-151 complexed with zn |
PDB Entry: 1wwr (more details), 1.8 Å
SCOP Domain Sequences for d1wwrc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwrc1 c.97.1.2 (C:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]} mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept lnhrvkweyypleeasellseffkklrnnii
Timeline for d1wwrc1: