Lineage for d1wwrc1 (1wwr C:1-151)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 711877Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 711878Superfamily c.97.1: Cytidine deaminase-like [53927] (4 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 711934Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (7 proteins)
    strand 5 is parallel to strand 4
  6. 711977Protein tRNA adenosine deaminase TadA [142840] (3 species)
  7. 711978Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry)
  8. 711981Domain d1wwrc1: 1wwr C:1-151 [121368]
    automatically matched to 1WWR A:1-151
    complexed with zn

Details for d1wwrc1

PDB Entry: 1wwr (more details), 1.8 Å

PDB Description: Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus
PDB Compounds: (C:) tRNA adenosine deaminase TadA

SCOP Domain Sequences for d1wwrc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwrc1 c.97.1.2 (C:1-151) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]}
mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike
acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept
lnhrvkweyypleeasellseffkklrnnii

SCOP Domain Coordinates for d1wwrc1:

Click to download the PDB-style file with coordinates for d1wwrc1.
(The format of our PDB-style files is described here.)

Timeline for d1wwrc1: