Lineage for d1wwrb2 (1wwr B:1-149)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918482Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2918566Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins)
    strand 5 is parallel to strand 4
  6. 2918643Protein tRNA adenosine deaminase TadA [142840] (3 species)
  7. 2918644Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry)
    Uniprot O67050 1-151
  8. 2918646Domain d1wwrb2: 1wwr B:1-149 [121367]
    Other proteins in same PDB: d1wwra2, d1wwrb3, d1wwrc3
    automated match to d1wwra1
    complexed with zn

Details for d1wwrb2

PDB Entry: 1wwr (more details), 1.8 Å

PDB Description: Crystal structure of tRNA adenosine deaminase TadA from Aquifex aeolicus
PDB Compounds: (B:) tRNA adenosine deaminase TadA

SCOPe Domain Sequences for d1wwrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwrb2 c.97.1.2 (B:1-149) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]}
mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike
acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept
lnhrvkweyypleeasellseffkklrnn

SCOPe Domain Coordinates for d1wwrb2:

Click to download the PDB-style file with coordinates for d1wwrb2.
(The format of our PDB-style files is described here.)

Timeline for d1wwrb2: