![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.2: Deoxycytidylate deaminase-like [89800] (8 proteins) strand 5 is parallel to strand 4 |
![]() | Protein tRNA adenosine deaminase TadA [142840] (3 species) |
![]() | Species Aquifex aeolicus [TaxId:63363] [142843] (1 PDB entry) Uniprot O67050 1-151 |
![]() | Domain d1wwrb2: 1wwr B:1-149 [121367] Other proteins in same PDB: d1wwra2, d1wwrb3, d1wwrc3 automated match to d1wwra1 complexed with zn |
PDB Entry: 1wwr (more details), 1.8 Å
SCOPe Domain Sequences for d1wwrb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwrb2 c.97.1.2 (B:1-149) tRNA adenosine deaminase TadA {Aquifex aeolicus [TaxId: 63363]} mgkeyflkvalreakrafekgevpvgaiivkegeiiskahnsveelkdptahaemlaike acrrlntkylegcelyvtlepcimcsyalvlsriekvifsaldkkhggvvsvfnildept lnhrvkweyypleeasellseffkklrnn
Timeline for d1wwrb2: