![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.330: ERH-like [143874] (1 superfamily) beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10 |
![]() | Superfamily d.330.1: ERH-like [143875] (1 family) ![]() |
![]() | Family d.330.1.1: ERH-like [143876] (1 protein) Pfam PF01133 |
![]() | Protein Enhancer of rudimentary homolog, ERH [143877] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries) also includes 100% identical human protein P84090 (1W9G) |
![]() | Domain d1wwqa1: 1wwq A:8-111 [121365] |
PDB Entry: 1wwq (more details)
SCOP Domain Sequences for d1wwqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwqa1 d.330.1.1 (A:8-111) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]} mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk
Timeline for d1wwqa1: