Lineage for d1wwqa1 (1wwq A:8-111)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741921Fold d.330: ERH-like [143874] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10
  4. 741922Superfamily d.330.1: ERH-like [143875] (1 family) (S)
  5. 741923Family d.330.1.1: ERH-like [143876] (1 protein)
    Pfam PF01133
  6. 741924Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)
  7. 741925Species Mouse (Mus musculus) [TaxId:10090] [143878] (4 PDB entries)
    also includes 100% identical human protein P84090 (1W9G)
  8. 741932Domain d1wwqa1: 1wwq A:8-111 [121365]

Details for d1wwqa1

PDB Entry: 1wwq (more details)

PDB Description: Solution Structure of Mouse ER
PDB Compounds: (A:) Enhancer of rudimentary homolog

SCOP Domain Sequences for d1wwqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwqa1 d.330.1.1 (A:8-111) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk

SCOP Domain Coordinates for d1wwqa1:

Click to download the PDB-style file with coordinates for d1wwqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wwqa1: