Lineage for d1wwqa1 (1wwq A:8-111)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011129Fold d.330: ERH-like [143874] (1 superfamily)
    beta(2)-alpha(2)-beta(2)-alpha; antiparallel beta-sheet, order:2134; helices are arranged in a bundle rather than packed agains beta-sheet; dimerises via with the formation of a flattened beta-barel: closed n=8, S=10
  4. 3011130Superfamily d.330.1: ERH-like [143875] (2 families) (S)
    automatically mapped to Pfam PF01133
  5. 3011131Family d.330.1.1: ERH-like [143876] (2 proteins)
    Pfam PF01133
  6. 3011132Protein Enhancer of rudimentary homolog, ERH [143877] (1 species)
  7. 3011133Species Mouse (Mus musculus) [TaxId:10090] [143878] (5 PDB entries)
    Uniprot P84089 1-104! Uniprot P84090 2-101
    also includes 100% identical human protein P84090 (1W9G)
  8. 3011139Domain d1wwqa1: 1wwq A:8-111 [121365]
    Other proteins in same PDB: d1wwqa2

Details for d1wwqa1

PDB Entry: 1wwq (more details)

PDB Description: solution structure of mouse er
PDB Compounds: (A:) Enhancer of rudimentary homolog

SCOPe Domain Sequences for d1wwqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwqa1 d.330.1.1 (A:8-111) Enhancer of rudimentary homolog, ERH {Mouse (Mus musculus) [TaxId: 10090]}
mshtillvqptkrpegrtyadyesvnecmegvckmyeehlkrmnpnspsitydisqlfdf
iddladlsclvyradtqtyqpynkdwikekiyvllrrqaqqagk

SCOPe Domain Coordinates for d1wwqa1:

Click to download the PDB-style file with coordinates for d1wwqa1.
(The format of our PDB-style files is described here.)

Timeline for d1wwqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wwqa2