SCOP 1.73: Domain d1wwmb1: 1wwm B:13-190

Lineage for d1wwmb1 (1wwm B:13-190)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (4 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (8 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein Hypothetical protein TTHA0169 (TT2028) [140950] (1 species)

7. Species Thermus thermophilus [TaxId:274] [140951] (1 PDB entry)

8. Domain d1wwmb1: 1wwm B:13-190 [121364]
   automatically matched to 1WWM A:11-190

Details for d1wwmb1

PDB Entry: 1wwm, 2.61 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TT2028

SCOP Domain Sequences for d1wwmb1:

Sequence, based on SEQRES records:

>d1wwmb1 a.132.1.3 (B:13-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvpe
egpwaelsqhwfapefqavlydlevlarglwedldpevvrtylrrileaekatwslll

Sequence, based on observed residues (ATOM records):

>d1wwmb1 a.132.1.3 (B:13-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvfq
avlydlevlarglwedldpevvrtylrrileaekatwslll

Timeline for d1wwmb1:

• d1wwmb1 is new in SCOP 1.73
  
• d1wwmb1 appears in SCOP 1.75
  
• d1wwmb1 appears in the current release, SCOPe 2.08, called d1wwmb_