SCOPe 2.08: Domain d1wwmb_: 1wwm B:

Lineage for d1wwmb_ (1wwm B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
   Pfam PF03070; HO-related family lacking the heme-binding site

6. Protein automated matches [190357] (2 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [188098] (1 PDB entry)

8. Domain d1wwmb_: 1wwm B: [121364]
   Other proteins in same PDB: d1wwma1
   automated match to d1wwma1

Details for d1wwmb_

PDB Entry: 1wwm, 2.61 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8

PDB Compounds: (B:) hypothetical protein TT2028

SCOPe Domain Sequences for d1wwmb_:

Sequence, based on SEQRES records:

>d1wwmb_ a.132.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvpe
egpwaelsqhwfapefqavlydlevlarglwedldpevvrtylrrileaekatwslll

Sequence, based on observed residues (ATOM records):

>d1wwmb_ a.132.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvfq
avlydlevlarglwedldpevvrtylrrileaekatwslll

Timeline for d1wwmb_:

• d1wwmb_ first appeared in SCOP 1.73, called d1wwmb1
  
• d1wwmb_ appears in SCOPe 2.07