Lineage for d1wwmb_ (1wwm B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011573Family a.132.1.3: TENA/THI-4 [101458] (9 protein domains)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 2011630Protein automated matches [190357] (2 species)
    not a true protein
  7. 2011634Species Thermus thermophilus HB8 [TaxId:300852] [188098] (1 PDB entry)
  8. 2011635Domain d1wwmb_: 1wwm B: [121364]
    Other proteins in same PDB: d1wwma1
    automated match to d1wwma1

Details for d1wwmb_

PDB Entry: 1wwm (more details), 2.61 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8
PDB Compounds: (B:) hypothetical protein TT2028

SCOPe Domain Sequences for d1wwmb_:

Sequence, based on SEQRES records: (download)

>d1wwmb_ a.132.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvpe
egpwaelsqhwfapefqavlydlevlarglwedldpevvrtylrrileaekatwslll

Sequence, based on observed residues (ATOM records): (download)

>d1wwmb_ a.132.1.3 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
pglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalmatv
eeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhvfq
avlydlevlarglwedldpevvrtylrrileaekatwslll

SCOPe Domain Coordinates for d1wwmb_:

Click to download the PDB-style file with coordinates for d1wwmb_.
(The format of our PDB-style files is described here.)

Timeline for d1wwmb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wwma1