Lineage for d1wwma1 (1wwm A:11-190)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 925023Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 925024Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 925151Family a.132.1.3: TENA/THI-4 [101458] (9 proteins)
    Pfam PF03070; HO-related family lacking the heme-binding site
  6. 925163Protein Hypothetical protein TTHA0169 (TT2028) [140950] (1 species)
  7. 925164Species Thermus thermophilus [TaxId:274] [140951] (1 PDB entry)
    Uniprot Q5SLX4 9-188
  8. 925165Domain d1wwma1: 1wwm A:11-190 [121363]
    Other proteins in same PDB: d1wwmb_

Details for d1wwma1

PDB Entry: 1wwm (more details), 2.61 Å

PDB Description: Crystal Structure of Conserved Hypothetical Protein TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TT2028

SCOPe Domain Sequences for d1wwma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwma1 a.132.1.3 (A:11-190) Hypothetical protein TTHA0169 (TT2028) {Thermus thermophilus [TaxId: 274]}
evpglleeikalplrldeerfrfwlqqdypfvealyryqvgllleapqahraplvqalma
tveeldwlllqgaspsapvhpvragyialleemgrlpyayrvvffyflnglfleawahhv
peegpwaelsqhwfapefqavlydlevlarglwedldpevvrtylrrileaekatwslll

SCOPe Domain Coordinates for d1wwma1:

Click to download the PDB-style file with coordinates for d1wwma1.
(The format of our PDB-style files is described here.)

Timeline for d1wwma1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wwmb_