Lineage for d1wwhd1 (1wwh D:170-249)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724455Protein Nucleoporin 35 [143330] (1 species)
  7. 724456Species Mouse (Mus musculus) [TaxId:10090] [143331] (1 PDB entry)
  8. 724460Domain d1wwhd1: 1wwh D:170-249 [121361]
    automatically matched to 1WWH A:169-249

Details for d1wwhd1

PDB Entry: 1wwh (more details), 2.7 Å

PDB Description: Crystal structure of the MPPN domain of mouse Nup35
PDB Compounds: (D:) nucleoporin 35

SCOP Domain Sequences for d1wwhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwhd1 d.58.7.1 (D:170-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}
lddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgr
ifgesimigvkpcidknvme

SCOP Domain Coordinates for d1wwhd1:

Click to download the PDB-style file with coordinates for d1wwhd1.
(The format of our PDB-style files is described here.)

Timeline for d1wwhd1: