Lineage for d1wwhc_ (1wwh C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952038Protein Nucleoporin 35 [143330] (1 species)
  7. 2952039Species Mouse (Mus musculus) [TaxId:10090] [143331] (1 PDB entry)
    Uniprot Q8R4R6 169-249
  8. 2952042Domain d1wwhc_: 1wwh C: [121360]
    automated match to d1wwha1

Details for d1wwhc_

PDB Entry: 1wwh (more details), 2.7 Å

PDB Description: Crystal structure of the MPPN domain of mouse Nup35
PDB Compounds: (C:) nucleoporin 35

SCOPe Domain Sequences for d1wwhc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwhc_ d.58.7.1 (C:) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]}
ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri
fgesimigvkpcidknvme

SCOPe Domain Coordinates for d1wwhc_:

Click to download the PDB-style file with coordinates for d1wwhc_.
(The format of our PDB-style files is described here.)

Timeline for d1wwhc_: