![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily) metal(zinc)-bound fold |
![]() | Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) ![]() |
![]() | Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins) |
![]() | Protein automated matches [254447] (3 species) not a true protein |
![]() | Species Murine leukemia virus [TaxId:11801] [254953] (4 PDB entries) |
![]() | Domain d1wwga_: 1wwg A: [121357] automated match to d1u6pa_ protein/RNA complex; complexed with zn |
PDB Entry: 1wwg (more details)
SCOPe Domain Sequences for d1wwga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wwga_ g.40.1.1 (A:) automated matches {Murine leukemia virus [TaxId: 11801]} atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
Timeline for d1wwga_: