Lineage for d1wwfa_ (1wwf A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640942Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 2640943Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 2640944Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 2640980Protein automated matches [254447] (3 species)
    not a true protein
  7. 2640985Species Murine leukemia virus [TaxId:11801] [254953] (4 PDB entries)
  8. 2640986Domain d1wwfa_: 1wwf A: [121356]
    automated match to d1u6pa_
    protein/RNA complex; complexed with zn

Details for d1wwfa_

PDB Entry: 1wwf (more details)

PDB Description: NMR Structure Determined for MLV NC Complex with RNA Sequence CCUCCGU
PDB Compounds: (A:) Nucleoprotein p10

SCOPe Domain Sequences for d1wwfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwfa_ g.40.1.1 (A:) automated matches {Murine leukemia virus [TaxId: 11801]}
atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll

SCOPe Domain Coordinates for d1wwfa_:

Click to download the PDB-style file with coordinates for d1wwfa_.
(The format of our PDB-style files is described here.)

Timeline for d1wwfa_: