Lineage for d1wwfa1 (1wwf A:14-53)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1244816Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 1244817Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 1244818Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (5 proteins)
  6. 1244847Protein Zinc finger protein ncp10 [57765] (1 species)
  7. 1244848Species Moloney murine leukemia virus, MoMLV [TaxId:11801] [57766] (6 PDB entries)
    Uniprot P03332 479-534
  8. 1244854Domain d1wwfa1: 1wwf A:14-53 [121356]
    automatically matched to d1a6bb_
    protein/RNA complex; complexed with zn

Details for d1wwfa1

PDB Entry: 1wwf (more details)

PDB Description: NMR Structure Determined for MLV NC Complex with RNA Sequence CCUCCGU
PDB Compounds: (A:) Nucleoprotein p10

SCOPe Domain Sequences for d1wwfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwfa1 g.40.1.1 (A:14-53) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]}
gerrrsqldrdqcayckekghwakdcpkkprgprgprpqt

SCOPe Domain Coordinates for d1wwfa1:

Click to download the PDB-style file with coordinates for d1wwfa1.
(The format of our PDB-style files is described here.)

Timeline for d1wwfa1: