Lineage for d1wwea_ (1wwe A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1705740Fold g.40: Retrovirus zinc finger-like domains [57755] (1 superfamily)
    metal(zinc)-bound fold
  4. 1705741Superfamily g.40.1: Retrovirus zinc finger-like domains [57756] (1 family) (S)
  5. 1705742Family g.40.1.1: Retrovirus zinc finger-like domains [57757] (6 proteins)
  6. 1705776Protein automated matches [254447] (3 species)
    not a true protein
  7. 1705781Species Murine leukemia virus [TaxId:11801] [254953] (4 PDB entries)
  8. 1705782Domain d1wwea_: 1wwe A: [121355]
    automated match to d1u6pa_
    protein/RNA complex; complexed with zn

Details for d1wwea_

PDB Entry: 1wwe (more details)

PDB Description: nmr structure determined for mlv nc complex with rna sequence uuuugcu
PDB Compounds: (A:) Nucleoprotein p10

SCOPe Domain Sequences for d1wwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wwea_ g.40.1.1 (A:) automated matches {Murine leukemia virus [TaxId: 11801]}
atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll

SCOPe Domain Coordinates for d1wwea_:

Click to download the PDB-style file with coordinates for d1wwea_.
(The format of our PDB-style files is described here.)

Timeline for d1wwea_: