SCOP 1.73: Domain d1wvla1: 1wvl A:1-66

Lineage for d1wvla1 (1wvl A:1-66)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.34: SH3-like barrel [50036] (18 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (3 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: "Histone-like" proteins from archaea [54161] (1 protein)

6. Protein DNA-binding protein [54162] (2 species)

7. Species Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId:2285] [54164] (9 PDB entries)

8. Domain d1wvla1: 1wvl A:1-66 [121343]
   automatically matched to d1azpa_

Details for d1wvla1

PDB Entry: 1wvl, 2.6 Å

PDB Description: Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer

PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d, GCN4

SCOP Domain Sequences for d1wvla1:

Sequence; same for both SEQRES and ATOM records:

>d1wvla1 b.34.13.1 (A:1-66) DNA-binding protein {Archaeon Sulfolobus acidocaldarius, Sac7d [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekk

Timeline for d1wvla1:

• d1wvla1 is new in SCOP 1.73
  
• d1wvla1 appears in SCOP 1.75
  
• d1wvla1 appears in the current release, SCOPe 2.08, called d1wvla_