![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.13: Chromo domain-like [54160] (4 families) ![]() SH3-like barrel is capped by a C-terminal helix |
![]() | Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins) |
![]() | Protein automated matches [190114] (2 species) not a true protein |
![]() | Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries) |
![]() | Domain d1wvla_: 1wvl A: [121343] automated match to d1azpa_ protein/DNA complex |
PDB Entry: 1wvl (more details), 2.6 Å
SCOPe Domain Sequences for d1wvla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvla_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]} mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar aerekkgvlkklravenelh
Timeline for d1wvla_: