SCOPe 2.08: Domain d1wvla_: 1wvl A:

Lineage for d1wvla_ (1wvl A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.13: Chromo domain-like [54160] (4 families)
   SH3-like barrel is capped by a C-terminal helix

5. Family b.34.13.1: Histone-like proteins from archaea [54161] (2 proteins)

6. Protein automated matches [190114] (2 species)
   not a true protein

7. Species Sulfolobus acidocaldarius [TaxId:2285] [186837] (12 PDB entries)

8. Domain d1wvla_: 1wvl A: [121343]
   automated match to d1azpa_
   protein/DNA complex

Details for d1wvla_

PDB Entry: 1wvl, 2.6 Å

PDB Description: Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer

PDB Compounds: (A:) DNA-binding proteins 7a/7b/7d, GCN4

SCOPe Domain Sequences for d1wvla_:

Sequence; same for both SEQRES and ATOM records:

>d1wvla_ b.34.13.1 (A:) automated matches {Sulfolobus acidocaldarius [TaxId: 2285]}
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekkgvlkklravenelh

Timeline for d1wvla_:

• d1wvla_ first appeared in SCOP 1.73, called d1wvla1
  
• d1wvla_ appears in SCOPe 2.07