Lineage for d1wvja2 (1wvj A:3-262)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913863Protein Glutamate receptor ligand binding core [53881] (5 species)
  7. 2913899Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries)
  8. 2914004Domain d1wvja2: 1wvj A:3-262 [121342]
    Other proteins in same PDB: d1wvja3
    automated match to d1lb8a_
    complexed with gol, ibc, so4

Details for d1wvja2

PDB Entry: 1wvj (more details), 1.75 Å

PDB Description: exploring the glur2 ligand-binding core in complex with the bicyclic ampa analogue (s)-4-ahcp
PDB Compounds: (A:) ionotropic glutamate receptor 2

SCOPe Domain Sequences for d1wvja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvja2 c.94.1.1 (A:3-262) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgecg

SCOPe Domain Coordinates for d1wvja2:

Click to download the PDB-style file with coordinates for d1wvja2.
(The format of our PDB-style files is described here.)

Timeline for d1wvja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wvja3