Lineage for d1wvha1 (1wvh A:1606-1738)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 672997Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 672998Superfamily b.55.1: PH domain-like [50729] (12 families) (S)
  5. 673212Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (12 proteins)
    Pfam PF00640
  6. 673265Protein Tensin [141421] (2 species)
  7. 673266Species Chicken (Gallus gallus) [TaxId:9031] [141423] (1 PDB entry)
  8. 673267Domain d1wvha1: 1wvh A:1606-1738 [121341]

Details for d1wvha1

PDB Entry: 1wvh (more details), 1.5 Å

PDB Description: Crystal structure of tensin1 PTB domain
PDB Compounds: (A:) Tensin

SCOP Domain Sequences for d1wvha1:

Sequence, based on SEQRES records: (download)

>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]}
aacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrklf
frrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkqgsttdnvchlfaeldpdqp
aaaivnfvsrvml

Sequence, based on observed residues (ATOM records): (download)

>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]}
aacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrklf
frrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkgsttdnvchlfaeldpdqpa
aaivnfvsrvml

SCOP Domain Coordinates for d1wvha1:

Click to download the PDB-style file with coordinates for d1wvha1.
(The format of our PDB-style files is described here.)

Timeline for d1wvha1: