Lineage for d1wvha1 (1wvh A:1606-1738)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803365Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 2803423Protein Tensin [141421] (2 species)
  7. 2803424Species Chicken (Gallus gallus) [TaxId:9031] [141423] (1 PDB entry)
    Uniprot Q04205 1606-1738
  8. 2803425Domain d1wvha1: 1wvh A:1606-1738 [121341]
    has additional insertions and/or extensions that are not grouped together

Details for d1wvha1

PDB Entry: 1wvh (more details), 1.5 Å

PDB Description: Crystal structure of tensin1 PTB domain
PDB Compounds: (A:) Tensin

SCOPe Domain Sequences for d1wvha1:

Sequence, based on SEQRES records: (download)

>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]}
aacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrklf
frrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkqgsttdnvchlfaeldpdqp
aaaivnfvsrvml

Sequence, based on observed residues (ATOM records): (download)

>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]}
aacnvlfinsvemesltgpqaiskavaetlvadptptativhfkvsaqgitltdnqrklf
frrhyplntvtfcdldpqerkwtktdgsgpaklfgfvarkgsttdnvchlfaeldpdqpa
aaivnfvsrvml

SCOPe Domain Coordinates for d1wvha1:

Click to download the PDB-style file with coordinates for d1wvha1.
(The format of our PDB-style files is described here.)

Timeline for d1wvha1: