Lineage for d1wvfa2 (1wvf A:7-242)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1933670Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1933671Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1933672Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins)
  6. 1933735Protein automated matches [254445] (2 species)
    not a true protein
  7. 1933741Species Pseudomonas putida [TaxId:303] [254950] (2 PDB entries)
  8. 1933742Domain d1wvfa2: 1wvf A:7-242 [121338]
    Other proteins in same PDB: d1wvfa1
    automated match to d1wvfa2
    complexed with acy, cl, fad, gol

Details for d1wvfa2

PDB Entry: 1wvf (more details), 1.3 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wvfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvfa2 d.145.1.1 (A:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOPe Domain Coordinates for d1wvfa2:

Click to download the PDB-style file with coordinates for d1wvfa2.
(The format of our PDB-style files is described here.)

Timeline for d1wvfa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wvfa1