SCOP 1.73: Domain d1wvfa2: 1wvf A:7-242

Lineage for d1wvfa2 (1wvf A:7-242)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.145: FAD-binding domain [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding domain [56176] (3 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species)
   the other subunit is a short-chain cytochrome c

7. Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries)

8. Domain d1wvfa2: 1wvf A:7-242 [121338]
   Other proteins in same PDB: d1wvfa1
   automatically matched to d1diia2
   complexed with acy, cl, fad, gol

Details for d1wvfa2

PDB Entry: 1wvf, 1.3 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOP Domain Sequences for d1wvfa2:

Sequence; same for both SEQRES and ATOM records:

>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

Timeline for d1wvfa2:

• d1wvfa2 is new in SCOP 1.73
  
• d1wvfa2 appears in SCOP 1.75
  
• d1wvfa2 appears in the current release, SCOPe 2.08