Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.145: FAD-binding domain [56175] (1 superfamily) consists of two alpha+beta subdomains |
Superfamily d.145.1: FAD-binding domain [56176] (3 families) |
Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins) |
Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species) the other subunit is a short-chain cytochrome c |
Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries) |
Domain d1wvfa2: 1wvf A:7-242 [121338] Other proteins in same PDB: d1wvfa1 automatically matched to d1diia2 complexed with acy, cl, fad, gol |
PDB Entry: 1wvf (more details), 1.3 Å
SCOP Domain Sequences for d1wvfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvfa2 d.145.1.1 (A:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1wvfa2: