![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein automated matches [190113] (15 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [186836] (1 PDB entry) |
![]() | Domain d1wved_: 1wve D: [121336] Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2 automated match to d1diqc_ complexed with acy, cl, fad, hem, trs |
PDB Entry: 1wve (more details), 1.85 Å
SCOPe Domain Sequences for d1wved_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wved_ a.3.1.1 (D:) automated matches {Pseudomonas putida [TaxId: 303]} sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde sltqvaeylsslpap
Timeline for d1wved_: