SCOP 1.73: Domain d1wved1: 1wve D:602-675

Lineage for d1wved1 (1wve D:602-675)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)

6. Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
   the other subunit is a flavoprotein

7. Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries)

8. Domain d1wved1: 1wve D:602-675 [121336]
   Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
   automatically matched to d1diqc_
   complexed with acy, cl, fad, hem, trs

Details for d1wved1

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (D:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOP Domain Sequences for d1wved1:

Sequence; same for both SEQRES and ATOM records:

>d1wved1 a.3.1.1 (D:602-675) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

Timeline for d1wved1:

• d1wved1 is new in SCOP 1.73
  
• d1wved1 appears in SCOP 1.75
  
• d1wved1 appears in the current release, SCOPe 2.08, called d1wved_