SCOPe 2.08: Domain d1wved_: 1wve D:

Lineage for d1wved_ (1wve D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (17 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [186836] (1 PDB entry)

8. Domain d1wved_: 1wve D: [121336]
   Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
   automated match to d1diqc_
   complexed with acy, cl, fad, hem, trs

Details for d1wved_

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (D:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOPe Domain Sequences for d1wved_:

Sequence; same for both SEQRES and ATOM records:

>d1wved_ a.3.1.1 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpap

Timeline for d1wved_:

• d1wved_ first appeared in SCOP 1.73, called d1wved1
  
• d1wved_ appears in SCOPe 2.07