Lineage for d1wved_ (1wve D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980370Family a.3.1.1: monodomain cytochrome c [46627] (16 protein domains)
  6. 1980768Protein automated matches [190113] (14 species)
    not a true protein
  7. 1980803Species Pseudomonas putida [TaxId:303] [186836] (1 PDB entry)
  8. 1980805Domain d1wved_: 1wve D: [121336]
    Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
    automated match to d1diqc_
    complexed with acy, cl, fad, hem, trs

Details for d1wved_

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (D:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOPe Domain Sequences for d1wved_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wved_ a.3.1.1 (D:) automated matches {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpap

SCOPe Domain Coordinates for d1wved_:

Click to download the PDB-style file with coordinates for d1wved_.
(The format of our PDB-style files is described here.)

Timeline for d1wved_: