SCOPe 2.04: Domain d1wvec_: 1wve C:

Lineage for d1wvec_ (1wve C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein automated matches [190113] (15 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [186836] (1 PDB entry)

8. Domain d1wvec_: 1wve C: [121335]
   Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
   automated match to d1diqc_
   complexed with acy, cl, fad, hem, trs

Details for d1wvec_

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (C:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOPe Domain Sequences for d1wvec_:

Sequence; same for both SEQRES and ATOM records:

>d1wvec_ a.3.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpap

Timeline for d1wvec_:

• d1wvec_ first appeared in SCOP 1.73, called d1wvec1
  
• d1wvec_ appears in SCOPe 2.03
  
• d1wvec_ appears in SCOPe 2.05
  
• d1wvec_ appears in the current release, SCOPe 2.08