Lineage for d1wvec_ (1wve C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257168Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1257169Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1257170Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 1257525Protein automated matches [190113] (12 species)
    not a true protein
  7. 1257557Species Pseudomonas putida [TaxId:303] [186836] (1 PDB entry)
  8. 1257558Domain d1wvec_: 1wve C: [121335]
    Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
    automated match to d1diqc_
    complexed with acy, cl, fad, hem, trs

Details for d1wvec_

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (C:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOPe Domain Sequences for d1wvec_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvec_ a.3.1.1 (C:) automated matches {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpap

SCOPe Domain Coordinates for d1wvec_:

Click to download the PDB-style file with coordinates for d1wvec_.
(The format of our PDB-style files is described here.)

Timeline for d1wvec_: