Lineage for d1wvec1 (1wve C:602-675)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 634089Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 634090Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries)
  8. 634091Domain d1wvec1: 1wve C:602-675 [121335]
    Other proteins in same PDB: d1wvea1, d1wvea2, d1wveb1, d1wveb2
    automatically matched to d1diqc_
    complexed with acy, cl, fad, hem, trs

Details for d1wvec1

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (C:) 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit

SCOP Domain Sequences for d1wvec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvec1 a.3.1.1 (C:602-675) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

SCOP Domain Coordinates for d1wvec1:

Click to download the PDB-style file with coordinates for d1wvec1.
(The format of our PDB-style files is described here.)

Timeline for d1wvec1: