SCOPe 2.04: Domain d1wveb2: 1wve B:7-242

Lineage for d1wveb2 (1wve B:7-242)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (7 proteins)

6. Protein automated matches [254445] (2 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [254950] (2 PDB entries)

8. Domain d1wveb2: 1wve B:7-242 [121334]
   Other proteins in same PDB: d1wvea1, d1wveb1, d1wvec_, d1wved_
   automated match to d1wvfa2
   complexed with acy, cl, fad, hem, trs

Details for d1wveb2

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (B:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wveb2:

Sequence; same for both SEQRES and ATOM records:

>d1wveb2 d.145.1.1 (B:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

Timeline for d1wveb2:

• d1wveb2 first appeared in SCOP 1.73
  
• d1wveb2 appears in SCOPe 2.03
  
• d1wveb2 appears in SCOPe 2.05
  
• d1wveb2 appears in the current release, SCOPe 2.08