![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (5 proteins) |
![]() | Protein Flavoprotein subunit of p-cresol methylhydroxylase [56180] (1 species) the other subunit is a short-chain cytochrome c |
![]() | Species Pseudomonas putida [TaxId:303] [56181] (4 PDB entries) |
![]() | Domain d1wveb2: 1wve B:7-242 [121334] Other proteins in same PDB: d1wvea1, d1wveb1, d1wvec_, d1wved_ automatically matched to d1diia2 complexed with acy, cl, fad, hem, trs |
PDB Entry: 1wve (more details), 1.85 Å
SCOPe Domain Sequences for d1wveb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wveb2 d.145.1.1 (B:7-242) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]} avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp
Timeline for d1wveb2:
![]() Domains from other chains: (mouse over for more information) d1wvea1, d1wvea2, d1wvec_, d1wved_ |