Lineage for d1wveb2 (1wve B:7-242)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. Protein automated matches [254445] (3 species)
    not a true protein
  7. Species Pseudomonas putida [TaxId:303] [254950] (2 PDB entries)
  8. Domain d1wveb2: 1wve B:7-242 [121334]
    Other proteins in same PDB: d1wvea1, d1wveb1, d1wvec_, d1wved_
    automated match to d1wvfa2
    complexed with acy, cl, fad, hem, trs

Details for d1wveb2

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (B:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wveb2 d.145.1.1 (B:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOPe Domain Coordinates for d1wveb2 are not available.

Timeline for d1wveb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wveb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1wvea1, d1wvea2, d1wvec_, d1wved_