SCOP 1.75: Domain d1wveb1: 1wve B:243-521

Lineage for d1wveb1 (1wve B:243-521)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (4 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (2 proteins)

6. Protein Flavoprotein subunit of p-cresol methylhydroxylase [55107] (1 species)
   the other subunit is a short-chain cytochrome c

7. Species Pseudomonas putida [TaxId:303] [55108] (4 PDB entries)

8. Domain d1wveb1: 1wve B:243-521 [121333]
   Other proteins in same PDB: d1wvea2, d1wveb2, d1wvec1, d1wved1
   automatically matched to d1diia1
   complexed with acy, cl, fad, hem, trs

Details for d1wveb1

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (B:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOP Domain Sequences for d1wveb1:

Sequence; same for both SEQRES and ATOM records:

>d1wveb1 d.58.32.1 (B:243-521) Flavoprotein subunit of p-cresol methylhydroxylase {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

Timeline for d1wveb1:

• d1wveb1 first appeared in SCOP 1.73
  
• d1wveb1 appears in SCOPe 2.01
  
• d1wveb1 appears in the current release, SCOPe 2.08