Lineage for d1wveb1 (1wve B:243-521)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2521989Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (7 families) (S)
    duplication: contains two subdomains of this fold
  5. 2521990Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
    automatically mapped to Pfam PF02913
  6. 2522031Protein automated matches [254446] (2 species)
    not a true protein
  7. 2522037Species Pseudomonas putida [TaxId:303] [254951] (2 PDB entries)
  8. 2522040Domain d1wveb1: 1wve B:243-521 [121333]
    Other proteins in same PDB: d1wvea2, d1wveb2, d1wvec_, d1wved_
    automated match to d1wvfa1
    complexed with acy, cl, fad, hem, trs

Details for d1wveb1

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (B:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wveb1 d.58.32.1 (B:243-521) automated matches {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

SCOPe Domain Coordinates for d1wveb1:

Click to download the PDB-style file with coordinates for d1wveb1.
(The format of our PDB-style files is described here.)

Timeline for d1wveb1: