Lineage for d1wvea2 (1wve A:7-242)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547892Family d.145.1.1: FAD-linked oxidases, N-terminal domain [56177] (8 proteins)
  6. 2547962Protein automated matches [254445] (3 species)
    not a true protein
  7. 2547973Species Pseudomonas putida [TaxId:303] [254950] (2 PDB entries)
  8. 2547975Domain d1wvea2: 1wve A:7-242 [121332]
    Other proteins in same PDB: d1wvea1, d1wveb1, d1wvec_, d1wved_
    automated match to d1wvfa2
    complexed with acy, cl, fad, hem, trs

Details for d1wvea2

PDB Entry: 1wve (more details), 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wvea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvea2 d.145.1.1 (A:7-242) automated matches {Pseudomonas putida [TaxId: 303]}
avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkp

SCOPe Domain Coordinates for d1wvea2:

Click to download the PDB-style file with coordinates for d1wvea2.
(The format of our PDB-style files is described here.)

Timeline for d1wvea2: