![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (6 families) ![]() duplication: contains two subdomains of this fold |
![]() | Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins) automatically mapped to Pfam PF02913 |
![]() | Protein automated matches [254446] (1 species) not a true protein |
![]() | Species Pseudomonas putida [TaxId:303] [254951] (2 PDB entries) |
![]() | Domain d1wvea1: 1wve A:243-521 [121331] Other proteins in same PDB: d1wvea2, d1wveb2, d1wvec_, d1wved_ automated match to d1wvfa1 complexed with acy, cl, fad, hem, trs |
PDB Entry: 1wve (more details), 1.85 Å
SCOPe Domain Sequences for d1wvea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvea1 d.58.32.1 (A:243-521) automated matches {Pseudomonas putida [TaxId: 303]} pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr vaqsygpvkrklehaikravdpnnilapgrsgidlnndf
Timeline for d1wvea1:
![]() Domains from other chains: (mouse over for more information) d1wveb1, d1wveb2, d1wvec_, d1wved_ |