SCOPe 2.04: Domain d1wvea1: 1wve A:243-521

Lineage for d1wvea1 (1wve A:243-521)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.32: FAD-linked oxidases, C-terminal domain [55103] (6 families)
   duplication: contains two subdomains of this fold

5. Family d.58.32.1: Vanillyl-alcohol oxidase-like [55104] (3 proteins)
   automatically mapped to Pfam PF02913

6. Protein automated matches [254446] (1 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:303] [254951] (2 PDB entries)

8. Domain d1wvea1: 1wve A:243-521 [121331]
   Other proteins in same PDB: d1wvea2, d1wveb2, d1wvec_, d1wved_
   automated match to d1wvfa1
   complexed with acy, cl, fad, hem, trs

Details for d1wvea1

PDB Entry: 1wve, 1.85 Å

PDB Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit

PDB Compounds: (A:) 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit

SCOPe Domain Sequences for d1wvea1:

Sequence; same for both SEQRES and ATOM records:

>d1wvea1 d.58.32.1 (A:243-521) automated matches {Pseudomonas putida [TaxId: 303]}
pvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepg
htpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdt
qpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygl
dyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdr
vaqsygpvkrklehaikravdpnnilapgrsgidlnndf

Timeline for d1wvea1:

• d1wvea1 first appeared in SCOP 1.73
  
• d1wvea1 appears in SCOPe 2.03
  
• d1wvea1 appears in SCOPe 2.05
  
• d1wvea1 appears in the current release, SCOPe 2.08