Lineage for d1wvbb1 (1wvb B:5-313)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698273Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 698274Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) (S)
  5. 698275Family c.42.1.1: Arginase-like amidino hydrolases [52769] (4 proteins)
    Pfam PF00491
  6. 698296Protein Arginase [52770] (5 species)
  7. 698328Species Human (Homo sapiens) [TaxId:9606] [142346] (5 PDB entries)
  8. 698338Domain d1wvbb1: 1wvb B:5-313 [121330]
    automatically matched to 1WVB A:5-313
    complexed with mn, s2c; mutant

Details for d1wvbb1

PDB Entry: 1wvb (more details), 2.3 Å

PDB Description: crystal structure of human arginase i: the mutant e256q
PDB Compounds: (B:) arginase 1

SCOP Domain Sequences for d1wvbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvbb1 c.42.1.1 (B:5-313) Arginase {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

SCOP Domain Coordinates for d1wvbb1:

Click to download the PDB-style file with coordinates for d1wvbb1.
(The format of our PDB-style files is described here.)

Timeline for d1wvbb1: