SCOPe 2.08: Domain d1wvbb_: 1wvb B:

Lineage for d1wvbb_ (1wvb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein automated matches [190112] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186835] (13 PDB entries)

8. Domain d1wvbb_: 1wvb B: [121330]
   Other proteins in same PDB: d1wvba1
   automated match to d1hqfa_
   complexed with mn, s2c; mutant

Details for d1wvbb_

PDB Entry: 1wvb, 2.3 Å

PDB Description: crystal structure of human arginase i: the mutant e256q

PDB Compounds: (B:) arginase 1

SCOPe Domain Sequences for d1wvbb_:

Sequence; same for both SEQRES and ATOM records:

>d1wvbb_ c.42.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

Timeline for d1wvbb_:

• d1wvbb_ first appeared in SCOP 1.73, called d1wvbb1
  
• d1wvbb_ appears in SCOPe 2.07