Lineage for d1wvba1 (1wvb A:5-313)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850944Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1850945Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1850946Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
    Pfam PF00491
  6. 1850967Protein Arginase [52770] (5 species)
  7. 1850999Species Human (Homo sapiens) [TaxId:9606] [142346] (26 PDB entries)
    Uniprot P05089 5-313
  8. 1851046Domain d1wvba1: 1wvb A:5-313 [121329]
    Other proteins in same PDB: d1wvbb_
    complexed with mn, s2c; mutant

Details for d1wvba1

PDB Entry: 1wvb (more details), 2.3 Å

PDB Description: crystal structure of human arginase i: the mutant e256q
PDB Compounds: (A:) arginase 1

SCOPe Domain Sequences for d1wvba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvba1 c.42.1.1 (A:5-313) Arginase {Human (Homo sapiens) [TaxId: 9606]}
srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
gtpvvggltyrqglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
glaregnhk

SCOPe Domain Coordinates for d1wvba1:

Click to download the PDB-style file with coordinates for d1wvba1.
(The format of our PDB-style files is described here.)

Timeline for d1wvba1: