Lineage for d1wv8a1 (1wv8 A:2-72)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616227Fold d.304: TTHA1013/TTHA0281-like [143099] (1 superfamily)
    beta(3)-alpha-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other; topological similarity to the SEP domain fold (102847); dimerises via the long C-terminal strand with the formation of a single beta-sheet
  4. 2616228Superfamily d.304.1: TTHA1013/TTHA0281-like [143100] (2 families) (S)
  5. 2616229Family d.304.1.1: TTHA1013-like [143101] (1 protein)
  6. 2616230Protein Hypothetical protein TTHA1013 [143102] (1 species)
  7. 2616231Species Thermus thermophilus [TaxId:274] [143103] (1 PDB entry)
    Uniprot Q5SJJ5 2-72
  8. 2616232Domain d1wv8a1: 1wv8 A:2-72 [121326]

Details for d1wv8a1

PDB Entry: 1wv8 (more details), 2.2 Å

PDB Description: Crystal structure of hypothetical protein TTHA1013 from an extremely thermophilic bacterium thermus thermophilus HB8
PDB Compounds: (A:) hypothetical protein TTHA1013

SCOPe Domain Sequences for d1wv8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wv8a1 d.304.1.1 (A:2-72) Hypothetical protein TTHA1013 {Thermus thermophilus [TaxId: 274]}
rtlkvqalwdgeagvwvaesddvpglateaatleellaklavmvpelleengvalelpve
lrleatrplvf

SCOPe Domain Coordinates for d1wv8a1:

Click to download the PDB-style file with coordinates for d1wv8a1.
(The format of our PDB-style files is described here.)

Timeline for d1wv8a1: