![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.304: TTHA1013/TTHA0281-like [143099] (1 superfamily) beta(3)-alpha-beta; 2 layers; mixed beta-sheet, order 4123, strands 1 and 4 are parallel to each other; topological similarity to the SEP domain fold (102847); dimerises via the long C-terminal strand with the formation of a single beta-sheet |
![]() | Superfamily d.304.1: TTHA1013/TTHA0281-like [143100] (2 families) ![]() |
![]() | Family d.304.1.1: TTHA1013-like [143101] (1 protein) |
![]() | Protein Hypothetical protein TTHA1013 [143102] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143103] (1 PDB entry) Uniprot Q5SJJ5 2-72 |
![]() | Domain d1wv8a1: 1wv8 A:2-72 [121326] |
PDB Entry: 1wv8 (more details), 2.2 Å
SCOPe Domain Sequences for d1wv8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wv8a1 d.304.1.1 (A:2-72) Hypothetical protein TTHA1013 {Thermus thermophilus [TaxId: 274]} rtlkvqalwdgeagvwvaesddvpglateaatleellaklavmvpelleengvalelpve lrleatrplvf
Timeline for d1wv8a1: