SCOPe 2.08: Domain d1wv7t2: 1wv7 T:109-209

Lineage for d1wv7t2 (1wv7 T:109-209)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d1wv7t2: 1wv7 T:109-209 [121325]
   Other proteins in same PDB: d1wv7h_, d1wv7l1, d1wv7l2, d1wv7l3
   automatically matched to d1a21a2
   complexed with 5pi, bgc, ca, fuc

Details for d1wv7t2

PDB Entry: 1wv7, 2.7 Å

PDB Description: human factor viia-tissue factor complexed with ethylsulfonamide-d-5- propoxy-trp-gln-p-aminobenzamidine

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d1wv7t2:

Sequence, based on SEQRES records:

>d1wv7t2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstdspvec

Sequence, based on observed residues (ATOM records):

>d1wv7t2 b.1.2.1 (T:109-209) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywksgkktaktn
tneflidvdkgenycfsvqavipsrtvnrkstdspvec

Timeline for d1wv7t2:

• d1wv7t2 first appeared in SCOP 1.73
  
• d1wv7t2 appears in SCOPe 2.07